{"product_id":"proteintech-27674-1-ap","title":"Proteintech, 27674-1-AP, A2ML1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe A2ML1 (27674-1-AP) by Proteintech is a Polyclonal antibody targeting A2ML1 in WB, ELISA applications with reactivity to Human samples\n27674-1-AP targets A2ML1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nA2ML1 is a member of the alpha-macroglobulin superfamily. It is thought to be an N-glycosylated monomeric protein that acts as an inhibitor of several proteases. It has been shown to form covalent interactions with proteases, and has been reported as the p170 antigen recognized by autoantibodies in the autoimmune disease paraneoplastic pemphigus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25818 Product name: Recombinant human A2ML1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1375-1454 aa of BC112131 Sequence: FSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE Predict reactive species\nFull Name: alpha-2-macroglobulin-like 1\nCalculated Molecular Weight: 1454 aa, 161 kDa\nObserved Molecular Weight: 161 kDa\nGenBank Accession Number: BC112131\nGene Symbol: A2ML1\nGene ID (NCBI): 144568\nRRID: AB_3085984\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A8K2U0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869796913321,"sku":"27674-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27674-1-ap","provider":"Iright","version":"1.0","type":"link"}