{"product_id":"proteintech-27679-1-ap","title":"Proteintech, 27679-1-AP, SAP30 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SAP30 (27679-1-AP) by Proteintech is a Polyclonal antibody targeting SAP30 in WB, ELISA applications with reactivity to Human samples\n27679-1-AP targets SAP30 in WB, IF, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HL-60 cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSAP30, also named as Sin3 corepressor complex subunit SAP30, is a 220 amino acid protein, which is expressed in all tissues tested with highest levels in pancreas, ovary, PBL, spleen and thymus. SAP30 is involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26516 Product name: Recombinant human SAP30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-197 aa of BC016757 Sequence: CLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTL Predict reactive species\nFull Name: Sin3A-associated protein, 30kDa\nCalculated Molecular Weight: 220 aa, 23 kDa\nObserved Molecular Weight: 23-28 kDa\nGenBank Accession Number: BC016757\nGene Symbol: SAP30\nGene ID (NCBI): 8819\nRRID: AB_2880945\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75446\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869592047785,"sku":"27679-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27679-1-ap","provider":"Iright","version":"1.0","type":"link"}