{"product_id":"proteintech-27681-1-ap","title":"Proteintech, 27681-1-AP, AGAP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AGAP3 (27681-1-AP) by Proteintech is a Polyclonal antibody targeting AGAP3 in WB, ELISA applications with reactivity to human samples\n27681-1-AP targets AGAP3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAGAP3, also known as MRIP-1, CENTG3, contains multiple signaling domains, a GTPase-like domain, a pleckstrin homology domain, and an ArfGAP domain, and exists as a component of the NMDA receptor complex. AGAP3 is a component of the NMDA receptor complex that regulates Arf6 and Ras\/ERK signaling (PMID: 23904596).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26662 Product name: Recombinant human AGAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 474-556 aa of BC044644 Sequence: LAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFT Predict reactive species\nFull Name: ArfGAP with GTPase domain, ankyrin repeat and PH domain 3\nCalculated Molecular Weight: 95 kDa\nObserved Molecular Weight: 95 kDa\nGenBank Accession Number: BC044644\nGene Symbol: AGAP3\nGene ID (NCBI): 116988\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96P47\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869804843177,"sku":"27681-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27681-1-ap","provider":"Iright","version":"1.0","type":"link"}