{"product_id":"proteintech-27697-1-ap","title":"Proteintech, 27697-1-AP, INSL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INSL5 (27697-1-AP) by Proteintech is a Polyclonal antibody targeting INSL5 in WB, ELISA applications with reactivity to mouse, rat samples\n27697-1-AP targets INSL5 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInsulin-like peptide 5 (INSL5), also named as UNQ156\/PRO182, is a member of the relaxin\/insulin superfamily and presents a tertiary structure similar to that of other insulin family members. It is located outside the cell membranes and highly expressed in rectum with lower levels in uterus and ascending and descending colon (PMID: 10458910). The calculated molecular weight of INSL5 is 15 kDa. A recent report suggested an important role for Isnl5 in the regulation of insulin secretion and b-cell homeostasis. Other reports identified that colonic Isnl5 expression is reduced by the gut microbiota and energy availability. In human diseases, INSL5 has been identified recently in colonic tissue and neuroendocrine tumors, but its specific functions in tumors remain to be elucidated(PMID: 32657028).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26833 Product name: Recombinant human INSL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 49-135 aa of BC101646 Sequence: HLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC Predict reactive species\nFull Name: insulin-like 5\nObserved Molecular Weight: 12-15 kDa\nGenBank Accession Number: BC101646\nGene Symbol: INSL5\nGene ID (NCBI): 10022\nRRID: AB_3085985\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5Q6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887684964521,"sku":"27697-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27697-1-ap","provider":"Iright","version":"1.0","type":"link"}