{"product_id":"proteintech-27703-1-ap","title":"Proteintech, 27703-1-AP, Cadherin-6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cadherin-6 (27703-1-AP) by Proteintech is a Polyclonal antibody targeting Cadherin-6 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n27703-1-AP targets Cadherin-6 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat kidney tissue, mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Cadherin-6 (CDH6), also known as K-cadherin, is a class II cadherin involved in the morphogenesis of the central nervous system and kidney (PMID: 27375021). Expression of cadherin-6 has also been described in some cancers, including renal cancer, ovarian cancer, gastric cancer, and thyroid cancer (PMID: 14665853; 28526733; 34530820). Cadherin-6 is involved in epithelial-mesenchymal transition (EMT) and cancer metastasis (PMID: 27375021).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26756 Product name: Recombinant human CDH6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 619-663 aa of BC000019 Sequence: ILLCIVILLGKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI Predict reactive species\nFull Name: cadherin 6, type 2, K-cadherin (fetal kidney)\nCalculated Molecular Weight: 790 aa, 88 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC000019\nGene Symbol: Cadherin-6\nGene ID (NCBI): 1004\nRRID: AB_3085988\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55285\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885742936233,"sku":"27703-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27703-1-ap","provider":"Iright","version":"1.0","type":"link"}