{"product_id":"proteintech-27706-1-ap","title":"Proteintech, 27706-1-AP, RREB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RREB1 (27706-1-AP) by Proteintech is a Polyclonal antibody targeting RREB1 in WB, IHC, ELISA applications with reactivity to human samples\n27706-1-AP targets RREB1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, LNCaP cells\nPositive IHC detected in: human colon cancer tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRREB1, also named as FINB and Zep-1, belongs to the krueppel C2H2-type zinc-finger protein family.RREB1 is a transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. RREB1 may be involved in Ras\/Raf-mediated cell differentiation by enhancing calcitonin expression. RREB1 represses the angiotensinogen gene. RREB1 can induce expression of p53 and represse p16 which associated with the expression of tumour. It has been reported that the RREB1 can be a candidate gene for type 2 diabetes associated end-stage kidney disease. To some extent, the decrease of zinc in human pancreatic adenocarcinoma is associated with the downregulation of RREB1. RREB1 has some isoforms with 250 kDa, 180-200 kDa and 140-160 kDa protein.(PMID: 21703425, 15067362, 25050557, 25027322)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26780 Product name: Recombinant human RREB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1324-1514 aa of NM_001003698 Sequence: MREEHGRGESHEPEEEHGTEESTGDADGAEEDASSNQSLDLDFATKLMDFKLAEGDGEAGAGGAASQEQKLACDTCGKSFKFLGTLSRHRKAHGRQEPKDEKGDGASTAEEGPQPAPEQEEKPPETPAEVVESAPGAGEAPAEKLAEETEGPSDGESAAEKRSSEKSDDDKKPKTDSPKSVASKADKRKKVC Predict reactive species\nFull Name: ras responsive element binding protein 1\nCalculated Molecular Weight: 181 kDa\nObserved Molecular Weight: 250 kDa\nGenBank Accession Number: NM_001003698\nGene Symbol: RREB1\nGene ID (NCBI): 6239\nRRID: AB_2880948\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92766\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887789363369,"sku":"27706-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27706-1-ap","provider":"Iright","version":"1.0","type":"link"}