{"product_id":"proteintech-27718-1-ap","title":"Proteintech, 27718-1-AP, PRDM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRDM2 (27718-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM2 in WB, ELISA applications with reactivity to Human samples\n27718-1-AP targets PRDM2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRDM2, also named as KMT8, RIZ, is a 1718 amino acid protein, which belongs to the class V-like SAM-binding methyltransferase superfamily. PRDM2 localizes in the nucleus and is highly expressed in retinoblastoma cell lines and in brain tumors and is also expressed in a number of other cell lines and in brain, heart, skeletal muscle, liver and spleen. Isoform 1 is expressed in testis at much higher level than isoform 3. PRDM2 as a S-adenosyl-L-methionine-dependent histone methyltransferase that specifically methylates 'Lys-9' of histone H3. May function as a DNA-binding transcription factor. The calculated molecular weight of PRDM2 is about 189 kDa. PRDM2 exists some isoforms with 250 kDa and 280 kDa. (PMID: 26040698)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26769 Product name: Recombinant human PRDM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-264 aa of NM_001007257 Sequence: MGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSANMRDSAEGPKEDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVN Predict reactive species\nFull Name: PR domain containing 2, with ZNF domain\nCalculated Molecular Weight: 189 kDa\nObserved Molecular Weight: 250-280 kDa\nGenBank Accession Number: NM_001007257\nGene Symbol: PRDM2\nGene ID (NCBI): 7799\nRRID: AB_2880951\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13029\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869577105577,"sku":"27718-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27718-1-ap","provider":"Iright","version":"1.0","type":"link"}