{"product_id":"proteintech-27741-1-ap","title":"Proteintech, 27741-1-AP, TRAFD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAFD1 (27741-1-AP) by Proteintech is a Polyclonal antibody targeting TRAFD1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n27741-1-AP targets TRAFD1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  K-562 cells,  A549 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human tonsillitis tissue, human intrahepatic cholangiocarcinoma tissue,  human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRAFD1, also known as TRAF-type zinc finger domain containing 1, is a protein that plays a significant role in immune system signaling pathways. It was first identified as an interferon- (IFN) and lipopolysaccharide- (LPS) inducible factor. TRAFD1 contains a TRAF-type zinc finger domain at its N-terminus and a TRAF6-binding motif in its middle region, which allows it to interact with other TRAF proteins and modulate immune responses. In the context of immune signaling, TRAFD1 has been shown to suppress the inflammatory responses to innate immunity by inhibiting Toll-like receptor 4 (TLR4) dependent NF-κB and MAPK activation in monocytes\/macrophages. This suggests that TRAFD1 can act as a negative regulator of immune signaling, dampening the inflammatory response. Moreover, TRAFD1 has been implicated in human diseases. It is overexpressed in many B cell-related cancers, and single nucleotide polymorphisms (SNPs) in TRAFD1 have been linked to non-Hodgkin's lymphoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26945 Product name: Recombinant human TRAFD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-335 aa of BC003553 Sequence: HEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGEEKRNEVAIPPNAYDESWGQDGIWIASQLLRQIEALDPPMRLPRRPLRAFESDVFHNRTTNQRNITAQVSIQNNLFEEQERQERNRGQQPPKEGGEESANLDFMLALSLQNEGQASSVAEQDFWRAVCEADQSHGGPRSLSDIKGAADEIMLPCEFCEELYPEELLIDHQTSCNPSRALPSLNTGSSSPRGVEEPD Predict reactive species\nFull Name: TRAF-type zinc finger domain containing 1\nCalculated Molecular Weight: 582 aa, 65 kDa\nObserved Molecular Weight: 65-80 kDa\nGenBank Accession Number: BC003553\nGene Symbol: TRAFD1\nGene ID (NCBI): 10906\nRRID: AB_2880958\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14545\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869780431017,"sku":"27741-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27741-1-ap","provider":"Iright","version":"1.0","type":"link"}