{"product_id":"proteintech-27755-1-ap","title":"Proteintech, 27755-1-AP, HOGA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOGA1 (27755-1-AP) by Proteintech is a Polyclonal antibody targeting HOGA1 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n27755-1-AP targets HOGA1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOGA1 (4-hydroxy-2-oxoglutarate aldolase), also known as C10orf65, DHDPSL, is a mitochondrial enzyme that plays a gatekeeper role in hydroxyproline metabolis. HOGA1 is primarily expressed in liver and kidney and catalyzes the final step of mitochondrial hydroxyproline metabolism\\ from 4-hydroxy-2-oxoglutarate to glyoxylate and pyruvate (PMID: 31696211). Identification of mutations in the HOGA1 gene as the cause of autosomal recessive primary hyperoxaluria (PH) type III has revitalized research in the field of PH and related stone disease (PMID: 22781098).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26849 Product name: Recombinant human C10orf65 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-327 aa of BC045550 Sequence: VVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSSAALIHHYTKVADLSPIPVVLYSVPANTGLDLPVDAVVTLSQHPNIVGMKDSGGDVTRIGLIVHKTRKQDFQVLAGSAGFLMASYALGAVGGVCALANVLGAQVCQLERLCCTGQWEDAQKLQHRLIEPNAAVTRRFGIPGLKKIMDWFGYYGGPCRAPLQELSPAEEEALRMDFTSNGWL Predict reactive species\nFull Name: chromosome 10 open reading frame 65\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC045550\nGene Symbol: HOGA1\nGene ID (NCBI): 112817\nRRID: AB_3669621\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86XE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887669858473,"sku":"27755-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27755-1-ap","provider":"Iright","version":"1.0","type":"link"}