{"product_id":"proteintech-27825-1-ap","title":"Proteintech, 27825-1-AP, MRP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRP1 (27825-1-AP) by Proteintech is a Polyclonal antibody targeting MRP1 in WB, IHC, ELISA applications with reactivity to Human samples\n27825-1-AP targets MRP1 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMultidrug resistant-associated protein 1 (MRP1, also known as ABCC1) is a member of the ATP-binding cassette (ABC) transporter protein superfamily, subfamily C. MRP1 is overexpressed in cancers and contributes to the occurrence of multidrug resistance (MDR). Expression of MRP1 has been considered as a negative marker for the outcome of chemotherapy. Recently MRP1 has been reported to play a crucial role in Aβ clearance at the blood-brain barrier.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27048 Product name: Recombinant human ABCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 918-1025 aa of NM_004996 Sequence: SSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGIS Predict reactive species\nFull Name: ATP-binding cassette, sub-family C (CFTR\/MRP), member 1\nCalculated Molecular Weight: 172 kDa\nObserved Molecular Weight: 180-190 kDa\nGenBank Accession Number: NM_004996\nGene Symbol: MRP1\nGene ID (NCBI): 4363\nRRID: AB_3085997\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P33527\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869561213097,"sku":"27825-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27825-1-ap","provider":"Iright","version":"1.0","type":"link"}