{"product_id":"proteintech-27878-1-ap","title":"Proteintech, 27878-1-AP, FOXD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOXD3 (27878-1-AP) by Proteintech is a Polyclonal antibody targeting FOXD3 in WB, ELISA applications with reactivity to Human samples\n27878-1-AP targets FOXD3 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFOXD3, also named as HFH2, belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXD3 binds to the consensus sequence 5'-A[AT]T[AG]TTTGTTT-3' and acts as a transcriptional repressor. It also acts as a transcriptional activator.  FOXD3 promotes development of neural crest cells from neural tube progenitors. It restricts neural progenitor cells to the neural crest lineage while suppressing interneuron differentiation. It required for maintenance of pluripotent cells in the pre-implantation and peri-implantation stages of embryogenesis. FOXD3 has one isoform produced by alternative splicing with the MW of 47 kDa. It can be detected as 57-60 kDa in some literature(PMID: 31940493).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27260 Product name: Recombinant human FOXD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-138 aa of NM_012183.2 Sequence: MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADEVPPAAPHHGQPQPPHQQPLTLPKEAAGAGAGPGGDVGAPEADGCKGGVGGEEGGASGGGPGAGSGSAGGLAPSKPKNS Predict reactive species\nFull Name: forkhead box D3\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 57-60 kDa\nGenBank Accession Number: NM_012183.2\nGene Symbol: FOXD3\nGene ID (NCBI): 27022\nRRID: AB_3086002\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UJU5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887642267817,"sku":"27878-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27878-1-ap","provider":"Iright","version":"1.0","type":"link"}