{"product_id":"proteintech-27879-1-ap","title":"Proteintech, 27879-1-AP, NEU3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NEU3 (27879-1-AP) by Proteintech is a Polyclonal antibody targeting NEU3 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse samples\n27879-1-AP targets NEU3 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HL-60 cells,  Jurkat cells,  K-562 cells,  THP-1 cells\nPositive IHC detected in: mouse testis tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27259 Product name: Recombinant human NEU3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 193-326 aa of NM_006656.5 Sequence: MPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSE Predict reactive species\nFull Name: sialidase 3 (membrane sialidase)\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48, 52 kDa\nGenBank Accession Number: NM_006656.5\nGene Symbol: NEU3\nGene ID (NCBI): 10825\nRRID: AB_2881002\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQ49\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869418770601,"sku":"27879-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27879-1-ap","provider":"Iright","version":"1.0","type":"link"}