{"product_id":"proteintech-27905-1-ap","title":"Proteintech, 27905-1-AP, SH3TC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SH3TC2 (27905-1-AP) by Proteintech is a Polyclonal antibody targeting SH3TC2 in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n27905-1-AP targets SH3TC2 in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human placenta tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe SH3TC2 protein (also known as KIAA1985 protein) is an adaptor protein involved in myelin formation in the peripheral nervous system. This protein contains multiple functional domains, including the SH3 (Src homology 3) and TPR (tetratricopeptide repeat) domains, which mediate protein-protein interactions. It is highly expressed in Schwann cells and is crucial for maintaining the stability of myelin structure.\nClinically, mutations in the SH3TC2 gene are associated with Charcot-Marie-Tooth disease type 4C (CMT4C), an autosomal recessive peripheral neuropathy characterized by progressive demyelination of motor and sensory nerves, limb weakness, and loss of sensation. Studies have shown that the absence or dysfunction of SH3TC2 protein can lead to disordered signaling pathways in Schwann cells (such as Rab11-mediated membrane transport defects), affecting myelin development and repair.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27352 Product name: Recombinant human SH3TC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-467 aa of BC113879 Sequence: CGLSRKRDWTGSYQIGRGRCKALTGYEPGEKDELNFYQGESIEIIGFVIPGLQWFIGKSTSSGQVGFVPTRNIDPDSYSPMSRNSAFLSDEERCSLLALGSDKQTECSSFLHTLARTDITSVYRLSGFESIQNPPNDLSASQPEGFKEVRPGRAWEEHQAVGSRQSSSSEDSSLEEELLSATSDSYRLPEPDDLDDPELLMDLSTGQEEEAENF Predict reactive species\nFull Name: SH3 domain and tetratricopeptide repeats 2\nCalculated Molecular Weight: 1288 aa, 145 kDa\nGenBank Accession Number: BC113879\nGene Symbol: SH3TC2\nGene ID (NCBI): 79628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TF17\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887800307881,"sku":"27905-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27905-1-ap","provider":"Iright","version":"1.0","type":"link"}