{"product_id":"proteintech-27941-1-ap","title":"Proteintech, 27941-1-AP, PTPRD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPRD (27941-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27941-1-AP targets PTPRD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, human placenta tissue,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPRD is a receptor-type protein tyrosine phosphatase that plays significant roles in various biological processes, including cell adhesion, synaptic function, and signal transduction. PTPRD is highly expressed in the brain, followed by the kidney, ovary, placenta, and intestine. Within the brain, it is found in specific regions, suggesting a role in neurological functions. PTPRD has emerged as a potential therapeutic target for various brain phenotypes and disorders. Its genetic variations have been associated with nervous system phenotypes, and the discovery of the first small molecule inhibitor of PTPRD phosphatase has opened new avenues for therapeutic intervention in addiction and possibly other PTPRD-associated disorders. Additionally, PTPRD is considered a tumor-suppressor gene that is down-regulated in hepatocellular carcinoma, suggesting its role in cancer progression and potential as a therapeutic target. The protein can recognize 175 kDa full length and 75 kDa mature cleavage product (PMID: 19074898, PMID: 25113440).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27689 Product name: Recombinant human PTPRD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1089-1225 aa of BC106714 Sequence: GNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEY Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, D\nCalculated Molecular Weight: 1912 aa, 215 kDa\nObserved Molecular Weight: 75 kDa, 175 kDa\nGenBank Accession Number: BC106714\nGene Symbol: PTPRD\nGene ID (NCBI): 5789\nRRID: AB_3086013\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23468\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887777042601,"sku":"27941-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27941-1-ap","provider":"Iright","version":"1.0","type":"link"}