{"product_id":"proteintech-27970-1-ap","title":"Proteintech, 27970-1-AP, CAMKMT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CAMKMT (27970-1-AP) by Proteintech is a Polyclonal antibody targeting CAMKMT in WB, IF\/ICC, ELISA applications with reactivity to Mouse, Rat, Human samples\n27970-1-AP targets CAMKMT in WB, IF\/ICC, ELISA applications and shows reactivity with Mouse, Rat, Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCAMKMT, also named as C2orf34 and CLNMT, belongs to the class I-like SAM-binding methyltransferase superfamily and CLNMT methyltransferase family. The CAMKMT enzyme participates in cell cycle and development, regulating the production of calmodulin with three methyl lysine residues directly or indirectly. It also plays a major role in the calcium-dependent signaling pathway and posttranscriptional modifications, including Lys-115. CAMKMT is expressed mainly in the brain, liver, muscle, colon, and lung and is involved in muscle cell activities that are regulated by calcium binding (PMID: 27435482). The molecular weight of CAMKMT is 36 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Mouse, Rat, Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27559 Product name: Recombinant human C2orf34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-311 aa of BC053733 Sequence: SADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEGHFDIVMCADCLFLDQYRASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENL Predict reactive species\nFull Name: chromosome 2 open reading frame 34\nCalculated Molecular Weight: 323 aa, 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC053733\nGene Symbol: CAMKMT\nGene ID (NCBI): 79823\nRRID: AB_3669631\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z624\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885787238569,"sku":"27970-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27970-1-ap","provider":"Iright","version":"1.0","type":"link"}