{"product_id":"proteintech-27973-1-ap","title":"Proteintech, 27973-1-AP, ALKBH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALKBH1 (27973-1-AP) by Proteintech is a Polyclonal antibody targeting ALKBH1 in WB, ELISA applications with reactivity to Human samples\n27973-1-AP targets ALKBH1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTwo RNA m6A demethylases, FTO and ALKBH5, have been identified since 2011, with both capable of removing the methyl group of m6A on poly-adenylated RNA through an iron-dependent oxidative demethylation mechanism. ALKBH1 as a RNA demethylase that mediates removal of the methyl group from N1-methyladenosine (m1A) in tRNA. ALKBH1 can tune translation initiation and elongation by regulating the cellular levels of tRNAiMet and the association of other ALKBH1 target tRNAs to polysomes, thereby affecting protein synthesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27520 Product name: Recombinant human ALKBH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-169 aa of BC025787 Sequence: ATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLR Predict reactive species\nFull Name: alkB, alkylation repair homolog 1 (E. coli)\nCalculated Molecular Weight: 389 aa, 44 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC025787\nGene Symbol: ALKBH1\nGene ID (NCBI): 8846\nRRID: AB_2881025\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13686\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869513601193,"sku":"27973-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27973-1-ap","provider":"Iright","version":"1.0","type":"link"}