{"product_id":"proteintech-27989-1-ap","title":"Proteintech, 27989-1-AP, SPEF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPEF2 (27989-1-AP) by Proteintech is a Polyclonal antibody targeting SPEF2 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n27989-1-AP targets SPEF2 in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue\nPositive IP detected in: rat testis tissue\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSperm flagellar protein 2 (SPEF2) is also named KPL2. As a cilia-associated protein, SPEF2 is broadly expressed in various cilia-related organs, such as the lung, spleen, trachea, brain, and testis (PMID: 10100999). SPEF2 is known to be essential for sperm tail development (PMID: 28619825). During spermatogenesis, SPEF2 is weakly expressed in cytoplasm in pachytene spermatocytes and round spermatocytes, then SPEF2 is localized in the manchette of steps 10-12 elongating spermatids, in the basal body at steps 13-14, and finally in the midpiece of the sperm tail at steps 14-16 (PMID: 19889948). Spef2 is expressed in the bone and cartilage, and Spef2 expression in osteoblasts increases during in vitro differentiation (PMID: 29339787).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27506 Product name: Recombinant human SPEF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 103-316 aa of NM_024867 Sequence: MALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDDEYIKKIQKRLEEDAFAREQREKRRRKLLM Predict reactive species\nFull Name: sperm flagellar 2\nCalculated Molecular Weight: 210 kDa\nObserved Molecular Weight: 210 kDa\nGenBank Accession Number: NM_024867\nGene Symbol: SPEF2\nGene ID (NCBI): 79925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C093\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887814398121,"sku":"27989-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27989-1-ap","provider":"Iright","version":"1.0","type":"link"}