{"product_id":"proteintech-27994-1-ap","title":"Proteintech, 27994-1-AP, MAGT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAGT1 (27994-1-AP) by Proteintech is a Polyclonal antibody targeting MAGT1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n27994-1-AP targets MAGT1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, NIH\/3T3 cells,  HuH-7 cells,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAGT1 is a mammalian Mg2+-selective transporter being required for cellular magnesium uptake and vertebrate embryonic development. It possesses five putative transmembrane (TM) regions with a cleavage site, a N-glycosylation site, and a number of phosphorylation sites. Recently mutations in MAGT1 has been found to be asscociated with a novel X-linked human immunodeficiency. The MAGT1 protein was undetectable in the patients' cells by western blot or immunofluorescent cell surface staining (Nature 475, 471-6). 27994-1-AP antibody detects the glycosylated protein around 45-50 kDa in SDS-PAGE. (PMID: 28720733, 27383987)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27416 Product name: Recombinant human MAGT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 266-335 aa of BC060842 Sequence: VAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS Predict reactive species\nFull Name: magnesium transporter 1\nCalculated Molecular Weight: 335 aa, 38 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC060842\nGene Symbol: MAGT1\nGene ID (NCBI): 84061\nRRID: AB_2881033\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0U3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869706473641,"sku":"27994-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-27994-1-ap","provider":"Iright","version":"1.0","type":"link"}