{"product_id":"proteintech-28007-1-ap","title":"Proteintech, 28007-1-AP, JNK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JNK (28007-1-AP) by Proteintech is a Polyclonal antibody targeting JNK in WB, IHC, ELISA applications with reactivity to Human, Mouse, canine samples\n28007-1-AP targets JNK in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, MDCK cells,  mouse brain tissue,  mouse cerebellum tissue\nPositive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJNK, also named MAPK10 (mitogen-activated protein kinase 10), belongs to MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is mainly expressed in a subset of neurons in the nervous system, and is activated by threonine and tyrosine phosphorylation. JNK has 3 isoforms of 48-53 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, canine\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27823 Product name: Recombinant human MAPK10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-408 aa of BC065516 Sequence: QWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNG Predict reactive species\nFull Name: mitogen-activated protein kinase 10\nCalculated Molecular Weight: 464 aa, 53 kDa\nObserved Molecular Weight: 45-48 kDa, 54-57 kDa\nGenBank Accession Number: BC065516\nGene Symbol: JNK3\nGene ID (NCBI): 5602\nRRID: AB_2881035\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P53779\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869001339049,"sku":"28007-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28007-1-ap","provider":"Iright","version":"1.0","type":"link"}