{"product_id":"proteintech-28058-1-ap","title":"Proteintech, 28058-1-AP, CD68 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD68 (28058-1-AP) by Proteintech is a Polyclonal antibody targeting CD68 in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples\n28058-1-AP targets CD68 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, mouse spleen tissue,  NR8383 cells\nPositive IHC detected in: mouse spleen tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:600-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMouse CD68 (also known as macrosialin) is a type I transmembrane glycoprotein that is highly and specifically expressed by mouse tissue macrophages, and to a lesser extent by dendritic cells. It belongs to the lysosomal\/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: mouse, rat, pig, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27827 Product name: Recombinant mouse Cd68 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-291 aa of NM_001291058 Sequence: MPSPRSKGALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGGCDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAVEYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASIVLSPAVHLDLLSLRLQAAQLPDKGHFGPCFSCNRDQS Predict reactive species\nFull Name: CD68 antigen\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: NM_001291058\nGene Symbol: Cd68\nGene ID (NCBI): 12514\nRRID: AB_2881049\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31996\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887956381865,"sku":"28058-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28058-1-ap","provider":"Iright","version":"1.0","type":"link"}