{"product_id":"proteintech-28079-1-ap","title":"Proteintech, 28079-1-AP, SCN1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCN1A (28079-1-AP) by Proteintech is a Polyclonal antibody targeting SCN1A in WB, ELISA applications with reactivity to human, mouse, rat samples\n28079-1-AP targets SCN1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSodium channel protein type 1 subunit alpha (SCN1A) is a multi-pass membrane protein that is crucial for generating and transmitting electrical signals in neurons, thereby contributing to the sensory perception of mechanically-induced pain (PMID: 14672992). SCN1A also regulates neuronal excitability and is essential for normal brain function (PMID: 37139072; 20831750).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25942 Product name: Recombinant human SCN1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 456-522 aa of NM_001165963 Sequence: MEAAQQAATATASEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFQK Predict reactive species\nFull Name: sodium channel, voltage-gated, type I, alpha subunit\nCalculated Molecular Weight: 229 kDa\nObserved Molecular Weight: 229-240 kDa\nGenBank Accession Number: NM_001165963\nGene Symbol: SCN1A\nGene ID (NCBI): 6323\nRRID: AB_2881054\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35498\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887794016425,"sku":"28079-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28079-1-ap","provider":"Iright","version":"1.0","type":"link"}