{"product_id":"proteintech-28080-1-ap","title":"Proteintech, 28080-1-AP, MRGPRE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRGPRE (28080-1-AP) by Proteintech is a Polyclonal antibody targeting MRGPRE in IHC, ELISA applications with reactivity to Human, rat samples\n28080-1-AP targets MRGPRE in IHC, ELISA applications and shows reactivity with Human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: rat dorsal root ganglion tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRGPRE (Mas-related G-protein coupled receptor member E, also named GPR167 ) may regulate nociceptor function or development, including the sensation or modulation of pain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24913 Product name: Recombinant human MRGPRE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-311 aa of BC104889 Sequence: AAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRETSRRGLVDIAA Predict reactive species\nFull Name: MAS-related GPR, member E\nCalculated Molecular Weight: 311 aa, 34 kDa\nGenBank Accession Number: BC104889\nGene Symbol: MRGPRE\nGene ID (NCBI): 116534\nRRID: AB_3669642\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86SM8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887724023977,"sku":"28080-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28080-1-ap","provider":"Iright","version":"1.0","type":"link"}