{"product_id":"proteintech-28081-1-ap","title":"Proteintech, 28081-1-AP, CYP26A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYP26A1 (28081-1-AP) by Proteintech is a Polyclonal antibody targeting CYP26A1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n28081-1-AP targets CYP26A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human placenta tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYP26A1 (Cytochrome P450 Family 26 Subfamily A Member 1), also known as Cytochrome P450 26A1, CP26, CYP26, P450RAI, and P450RAI1, is a member of the cytochrome P450 superfamily of enzymes, involved in retinoic acid (RA) metabolism and synthesis of cholesterol, steroids, and other lipids. CYP26A1 is essential for normal hindbrain patterning, vertebral identity, and development of posterior structures(PMID: 11157778).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24898 Product name: Recombinant human CYP26A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-220 aa of BC157063 Sequence: VHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRN Predict reactive species\nFull Name: cytochrome P450, family 26, subfamily A, polypeptide 1\nCalculated Molecular Weight: 497 aa, 56 kDa\nObserved Molecular Weight: 50-56 kDa\nGenBank Accession Number: BC157063\nGene Symbol: CYP26A1\nGene ID (NCBI): 1592\nRRID: AB_3669643\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43174\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887007322281,"sku":"28081-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28081-1-ap","provider":"Iright","version":"1.0","type":"link"}