{"product_id":"proteintech-28100-1-ap","title":"Proteintech, 28100-1-AP, KL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KL (28100-1-AP) by Proteintech is a Polyclonal antibody targeting KL in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n28100-1-AP targets KL in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27759 Product name: Recombinant human KL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-184 aa of NM_004795 Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG Predict reactive species\nFull Name: klotho\nCalculated Molecular Weight: 116 kDa\nObserved Molecular Weight: 62 kDa, 130 kDa\nGenBank Accession Number: NM_004795\nGene Symbol: KL\nGene ID (NCBI): 9365\nRRID: AB_2881060\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UEF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868862861481,"sku":"28100-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28100-1-ap","provider":"Iright","version":"1.0","type":"link"}