{"product_id":"proteintech-28113-1-ap","title":"Proteintech, 28113-1-AP, AKT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AKT2 (28113-1-AP) by Proteintech is a Polyclonal antibody targeting AKT2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n28113-1-AP targets AKT2 in WB, IHC, IF\/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, mouse liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAKT2 is one of 3 closely related serine\/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis and their activation has been observed in a wide variety of cancers. AKT2 is mainly involved in cancer cell survival, apoptosis inhibition, migration and invasion(PMID:21979951). Defects in AKT2 are a cause of susceptibility to breast cancer (BC). AKT2 promotes metastasis of tumor cells without affecting the latency of tumor development. And defects in AKT2 are a cause of non-insulin-dependent diabetes mellitus (NIDDM) and hypoinsulinemic hypoglycemia with hemihypertrophy (HIHGHH). The full length protein has four glycosylation sites.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27005 Product name: Recombinant human AKT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 335-481 aa of BC120994 Sequence: GLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE Predict reactive species\nFull Name: v-akt murine thymoma viral oncogene homolog 2\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC120994\nGene Symbol: AKT2\nGene ID (NCBI): 208\nRRID: AB_2881064\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31751\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868992065705,"sku":"28113-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28113-1-ap","provider":"Iright","version":"1.0","type":"link"}