{"product_id":"proteintech-28127-1-ap","title":"Proteintech, 28127-1-AP, ZBTB7B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZBTB7B (28127-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB7B in WB, ELISA applications with reactivity to Human, mouse samples\n28127-1-AP targets ZBTB7B in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZBTB7B, also known as Zfp-67 or Zinc finger protein Th-POK, is a 539 amino acid protein, which localizes in nucleus. ZBTB7B as a transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. ZBTB7B is necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. The calcualted molecular weight of ZBTB7B is about 58 kDa, but modified protein is 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27970 Product name: Recombinant human ZBTB7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-350 aa of BC012070 Sequence: APSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPV Predict reactive species\nFull Name: zinc finger and BTB domain containing 7B\nCalculated Molecular Weight: 539 aa, 58 kDa\nObserved Molecular Weight: 70 kda\nGenBank Accession Number: BC012070\nGene Symbol: ZBTB7B\nGene ID (NCBI): 51043\nRRID: AB_2881068\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15156\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887927185577,"sku":"28127-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28127-1-ap","provider":"Iright","version":"1.0","type":"link"}