{"product_id":"proteintech-28154-1-ap","title":"Proteintech, 28154-1-AP, PLEKHH3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLEKHH3 (28154-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHH3 in WB, ELISA applications with reactivity to Human, Mouse samples\n28154-1-AP targets PLEKHH3 in WB, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLEKHH3, a gene related to endothelial tight junction, is associated with obstructive sleep apnea (OSA) and angiogenesis. It has been reported that the expression of PLEKHH3 protein was increased in the OSA patients. PLEKHH3 may play a key role in OSA and angiogenesis by specifically regulating the endothelial cells formation of tight junctions. 28154-1-AP detects the isoforms of PLEKHH3 protein around 80-85 kDa in SDS-PAGE.(PMID:28520763)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28001 Product name: Recombinant human PLEKHH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 251-404 aa of BC052978 Sequence: YGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPALRDELFLQLAKQTSGPAGPPGLPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLERTEQALPDSELAEYARFIRKALGRTRGRELVPSLAEISALSQRQEL Predict reactive species\nFull Name: pleckstrin homology domain containing, family H (with MyTH4 domain) member 3\nCalculated Molecular Weight: 793 aa, 85 kDa\nObserved Molecular Weight: 85 and 80 kDa\nGenBank Accession Number: BC052978\nGene Symbol: PLEKHH3\nGene ID (NCBI): 79990\nRRID: AB_2881076\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z736\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887765967017,"sku":"28154-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28154-1-ap","provider":"Iright","version":"1.0","type":"link"}