{"product_id":"proteintech-28197-1-ap","title":"Proteintech, 28197-1-AP, ETV1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ETV1 (28197-1-AP) by Proteintech is a Polyclonal antibody targeting ETV1 in WB, ELISA applications with reactivity to human, mouse samples\n28197-1-AP targets ETV1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nETV1(Ets variant 1) is a member of ETS transcription factor family, which has become the research focus in cancer and cardiac electrophysiology in recent years. TMPRSS2-ETV1 gene fusion exists in about 1-2% of prostate cancer, while ETV1 is highly expressed in 5-10% of advanced tumors. Different from sibling factor ERG, ETV1 not only enhances the signal of androgen receptor (AR), but also can autonomously activate testosterone synthesis and cholesterol\/lipid metabolism reprogramming, cooperate with PTEN deficiency to promote the progress of local cancer to invasive adenocarcinoma, and predict higher Gleason score and poor prognosis, so it is regarded as an invasive subtype marker of \"metabolism-transcription dual drive\".\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28158 Product name: Recombinant human ETV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-213 aa of BC098403 Sequence: VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQR Predict reactive species\nFull Name: ets variant 1\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC098403\nGene Symbol: ETV1\nGene ID (NCBI): 2115\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50549\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887628439721,"sku":"28197-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28197-1-ap","provider":"Iright","version":"1.0","type":"link"}