{"product_id":"proteintech-28218-1-ap","title":"Proteintech, 28218-1-AP, FSTL3\/FLRG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FSTL3\/FLRG (28218-1-AP) by Proteintech is a Polyclonal antibody targeting FSTL3\/FLRG in WB, IHC, ELISA applications with reactivity to human, rat samples\n28218-1-AP targets FSTL3\/FLRG in WB, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, HeLa cells\nPositive IHC detected in: human urothelial carcinoma tissue, rat kidney tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFollistatin‐like 3 (FSTL3) is a highly conserved 27-39 kDa monomeric glycoprotein belonging to the follistatin protein family and it is primarily expressed in the placenta as well as in the testis, heart, adipose tissue, and pancreas. It is an extracellular inhibitor of the transforming growth factor beta (TGF‐β) family ligands, including activin, myostatin, and bone morphogenetic proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27626 Product name: Recombinant human FSTL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 94-263 aa of BC005839 Sequence: PCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFV Predict reactive species\nFull Name: follistatin-like 3 (secreted glycoprotein)\nCalculated Molecular Weight: 263 aa, 28 kDa\nObserved Molecular Weight: 28-33 kDa\nGenBank Accession Number: BC005839\nGene Symbol: FSTL3\nGene ID (NCBI): 10272\nRRID: AB_3086037\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95633\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644102825,"sku":"28218-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28218-1-ap","provider":"Iright","version":"1.0","type":"link"}