{"product_id":"proteintech-28261-1-ap","title":"Proteintech, 28261-1-AP, RNF139 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF139 (28261-1-AP) by Proteintech is a Polyclonal antibody targeting RNF139 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28261-1-AP targets RNF139 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HT-29 cells,  HepG2 cells,  THP-1 cells,  U-87 MG cells,  U2OS cells\nPositive IHC detected in: rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe RNF139 gene (ring-finger protein 139), also known as TRC8 (translocation in renal carcinoma from chromosome 8), was first identified from a family with 3;8 chromosomal translocation and hereditary renal cell carcinoma and thyroid cancer (PMID:22689053). RNF139 encodes an endoplasmic reticulum (ER) protein with 10 transmembrane segments that contain a sterol-sensing domain and a RING finger motif encoding an E3 ubiquitin ligase (PMID: 19706601). Northern blot and dot blot show that RNF139 is highly expressed in the testis, placenta, and adrenal gland and is expressed at lower levels in the heart, brain, liver, skeletal muscle, and pancreas (PMID: 9689122). It is reported that TRC8 suppresses tumorigenesis by targeting heme oxygenase-1 (HO-1), an antioxidant enzyme highly expressed in various cancers, for ubiquitination and degradation (PMID:22689053). TRC8 is also involved in cholesterol and fatty acid biosynthesis that are transcriptionally regulated by the sterol response element binding proteins (SREBPs) (PMID:17016439). Acetylation, phosphorylation, and autoubiquitination are common post-translational modifications of FNF139 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27147 Product name: Recombinant human RNF139 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 511-664 aa of BC064636 Sequence: QAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD Predict reactive species\nFull Name: ring finger protein 139\nCalculated Molecular Weight: 664 aa, 76 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC064636\nGene Symbol: RNF139\nGene ID (NCBI): 11236\nRRID: AB_3086042\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WU17\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887786053801,"sku":"28261-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28261-1-ap","provider":"Iright","version":"1.0","type":"link"}