{"product_id":"proteintech-28274-1-ap","title":"Proteintech, 28274-1-AP, RAB17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB17 (28274-1-AP) by Proteintech is a Polyclonal antibody targeting RAB17 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n28274-1-AP targets RAB17 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB17 is a member of the RAS oncogene family and is classified as a small GTPase that plays a crucial role in intracellular membrane trafficking  It is specifically expressed in epithelial cells and is involved in various cellular functions such as transcytosis, the directed movement of endocytosed material through the cell and its exocytosis from the plasma membrane at the opposite side. This process is mainly observed in epithelial cells and is important for the transcellular transport of substances like immunoglobulins from the basolateral surface to the apical surface. RAB17 is also implicated in the regulation of melanosome transport and release from melanocytes, which is critical for pigmentation in skin cells. Additionally, it has been suggested to regulate dendrite and dendritic spine development, which are important for neuronal function. The protein is involved in membrane trafficking through apical recycling endosomes in a post-endocytic step of transcytosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27206 Product name: Recombinant human RAB17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-212 aa of BC050426 Sequence: TRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQEREVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQAKCCAH Predict reactive species\nFull Name: RAB17, member RAS oncogene family\nCalculated Molecular Weight: 212 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC050426\nGene Symbol: RAB17\nGene ID (NCBI): 64284\nRRID: AB_2881103\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0T7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887778189481,"sku":"28274-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28274-1-ap","provider":"Iright","version":"1.0","type":"link"}