{"product_id":"proteintech-28301-1-ap","title":"Proteintech, 28301-1-AP, FOXJ2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOXJ2 (28301-1-AP) by Proteintech is a Polyclonal antibody targeting FOXJ2 in WB, ELISA applications with reactivity to human samples\n28301-1-AP targets FOXJ2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, U-87 MG cells,  human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFork head box J2 (FOXJ2) is a transcription factor discovered in mammals and other vertebrates in 2000, which belongs to the Fork head box (Fox) transcription factor family, which shares a conserved DNA-binding domain, known as Fork Head. FOXJ2 participates in the regulation of cell proliferation, differentiation, and migration by targeting downstream genes through its DNA binding domain, and plays fundamental roles in embryonic development, tumorigenesis, and the progression of certain cancers. The expression patterns of FOXJ2 have been reported to be aberrant in a variety of cancers, including breast cancer, extra-hepatic cholangiocarcinoma, nasopharyngeal carcinoma, glioma, and non-small cell lung cancer (PMID: 28769576, PMID: 33725831, PMID: 35908066). This antibody has been validated for knockdown.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27345 Product name: Recombinant human FOXJ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-271 aa of BC136305 Sequence: CPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVAGSGEASLPPEGNPQMSLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSYSEINFQDLSWSFRNLYKSMLEKSSSSSQ Predict reactive species\nFull Name: forkhead box J2\nCalculated Molecular Weight: 574 aa, 62 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC136305\nGene Symbol: FOXJ2\nGene ID (NCBI): 55810\nRRID: AB_3669651\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P0K8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887642693801,"sku":"28301-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28301-1-ap","provider":"Iright","version":"1.0","type":"link"}