{"product_id":"proteintech-28303-1-ap","title":"Proteintech, 28303-1-AP, ENPP3\/CD203c Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENPP3\/CD203c (28303-1-AP) by Proteintech is a Polyclonal antibody targeting ENPP3\/CD203c in WB, ELISA applications with reactivity to human, rat samples\n28303-1-AP targets ENPP3\/CD203c in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nENPP3\/CD203c is part of ectonucleotide pyrophosphatases\/phosphodiesterase (ENPP) family and plays a role in various physiological processes. Increased levels of ENPP3 have been observed in conditions, such as clear cell renal cell carcinoma, bile duct carcinoma, and colorectal cancer, positioning ENPP3 as a potential tumor marker (PMID: 38749434). Mice harboring a point mutant of ENPP3 that specifically abolishes its cGAMP hydrolase activity are more resistant to both primary tumor growth and metastasis in certain cancers (PMID: 38149831). High molecular weight band is the glycosylated form of ENPP3 (PMID: 27665743, 30271993)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28478 Product name: Recombinant human ENPP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 344-512 aa of BC146579 Sequence: VVDHAFGMLMEGLKQRNLHNCVNIILLADHGMDQTYCNKMEYMTDYFPRINFFYMYEGPAPRIRAHNIPHDFFSFNSEEIVRNLSCRKPDQHFKPYLTPDLPKRLHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPF Predict reactive species\nFull Name: ectonucleotide pyrophosphatase\/phosphodiesterase 3\nCalculated Molecular Weight: 875 aa, 100 kDa\nObserved Molecular Weight: 120-150 kDa\nGenBank Accession Number: BC146579\nGene Symbol: ENPP3\nGene ID (NCBI): 5169\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14638\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887544127657,"sku":"28303-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28303-1-ap","provider":"Iright","version":"1.0","type":"link"}