{"product_id":"proteintech-28335-1-ap","title":"Proteintech, 28335-1-AP, GFRAL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GFRAL (28335-1-AP) by Proteintech is a Polyclonal antibody targeting GFRAL in WB, ELISA applications with reactivity to human, mouse, rat samples\n28335-1-AP targets GFRAL in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGFRAL (GDNF family receptor alpha-like), also called C6orf144, is the brainstem-restricted receptor for GDF15 hormone, which triggers an aversive response, characterized by nausea, vomiting, and\/or loss of appetite in response to various stresses (PMID: 28846097, 28846098, 28846099, 28953886, 36630958). The GDF15-GFRAL signal induces expression of genes involved in metabolism, such as lipid metabolism in adipose tissues (PMID: 32661391). GFRAL is a single-pass membrane protein, and localizes to the plasma membrane. It is mainly expressed in the hindbrain, and its mainstream molecular weight is 45-60 kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28504 Product name: Recombinant human GFRAL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 94-338 aa of NM_207410 Sequence: MNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANK Predict reactive species\nFull Name: GDNF family receptor alpha like\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45-60 kDa\nGenBank Accession Number: NM_207410\nGene Symbol: GFRAL\nGene ID (NCBI): 389400\nRRID: AB_3669653\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXV0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887650132137,"sku":"28335-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28335-1-ap","provider":"Iright","version":"1.0","type":"link"}