{"product_id":"proteintech-28348-1-ap","title":"Proteintech, 28348-1-AP, Integrin alpha-9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin alpha-9 (28348-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha-9 in WB, ELISA applications with reactivity to Human, Mouse samples\n28348-1-AP targets Integrin alpha-9 in WB, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). Integrin alpha 9 contains a large N-terminal extracellular domain with 7 conserved repeats of putative metal-binding domains, a transmembrane segment, and a short C-terminal cytoplasmic tail (PMID: 8245132). Integrin alpha 9 interacts with integrin beta 1 generating α9β1 heterodimer, which is expressed in many cell types including epithelial cells, neutrophils, hepatocytes, muscle and endothelial cells (PMID: 21975548). It binds to a diversity of ligands in the extracellular matrix, like the a-disintegrin and metalloprotease (ADAM) family, THBS1, EMILIN1, VEGF, tenascin-C, osteopontin, fibronectin, and VCAM1 (PMID: 21975548; 33790909). Integrin α9β1 has been implicated in diverse biological functions including angiogenesis, lymphangiogenesis, lymphatic valve morphogenesis, granulopoiesis and tumorigenesis (PMID: 20179422).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28815 Product name: Recombinant human Integrin alpha-9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 462-613 aa of BC030198 Sequence: VITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPEEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQ Predict reactive species\nFull Name: integrin, alpha 9\nCalculated Molecular Weight: 114 kDa\nObserved Molecular Weight: 135 kDa\nGenBank Accession Number: BC030198\nGene Symbol: Integrin alpha 9\nGene ID (NCBI): 3680\nRRID: AB_3669655\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13797\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887685324969,"sku":"28348-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28348-1-ap","provider":"Iright","version":"1.0","type":"link"}