{"product_id":"proteintech-28351-1-ap","title":"Proteintech, 28351-1-AP, PRKAR2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRKAR2B (28351-1-AP) by Proteintech is a Polyclonal antibody targeting PRKAR2B in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n28351-1-AP targets PRKAR2B in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells, human testis tissue,  mouse brain tissue,  mouse eye tissue,  rat brain tissue,  mouse testis tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Neuro-2a cells, SH-SY5Y cells\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28787 Product name: Recombinant human PRKAR2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC075800 Sequence: MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFCHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNP Predict reactive species\nFull Name: protein kinase, cAMP-dependent, regulatory, type II, beta\nCalculated Molecular Weight: 418 aa, 46 kDa\nObserved Molecular Weight: 46-50 kDa\nGenBank Accession Number: BC075800\nGene Symbol: PRKAR2B\nGene ID (NCBI): 5577\nRRID: AB_2918156\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31323\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869736685737,"sku":"28351-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28351-1-ap","provider":"Iright","version":"1.0","type":"link"}