{"product_id":"proteintech-28365-1-ap","title":"Proteintech, 28365-1-AP, CRLF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRLF2 (28365-1-AP) by Proteintech is a Polyclonal antibody targeting CRLF2 in WB, ELISA applications with reactivity to human samples\n28365-1-AP targets CRLF2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytokine receptor-like factor 2 (CRLF2), also known as the thymic stromal derived lymphopoietin receptor (TSLPR), which in combination with the interleukin 7 receptor a chain (IL-7R) forms the receptor for thymic stromal lymphopoietin. CRLF2 is a type I cytokine receptor. CRLF2 rearrangements occur either as a translocation to the immunoglobulin heavy-chain enhancer region (IGH-CRLF2) or by a deletion of upstream PAR1 that leads to joining of CRLF2 to adjacent P2RY8. CRLF2 is expressed in heart, skeletal muscle, kidney and adult and fetal liver and is primarily expressed in dendrites and monocytes. (PMID: 20807819; 31644323; 33485429)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26842 Product name: Recombinant human CRLF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-123 aa of NM_001012288 Sequence: MGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPK Predict reactive species\nFull Name: cytokine receptor-like factor 2\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: NM_001012288\nGene Symbol: CRLF2\nGene ID (NCBI): 64109\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HC73\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886867239081,"sku":"28365-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28365-1-ap","provider":"Iright","version":"1.0","type":"link"}