{"product_id":"proteintech-28366-1-ap","title":"Proteintech, 28366-1-AP, BOP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BOP1 (28366-1-AP) by Proteintech is a Polyclonal antibody targeting BOP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse samples\n28366-1-AP targets BOP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, HeLa cells,  NCI-H1299 cells\nPositive IHC detected in: human colon cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBlock of Proliferation 1(BOP1) protein was first isolated from a mouse, and the truncation protein may led to cell cycle arrest. Bop1 plays a role in processing of the 28S and 5.8S rRNAs (ribosomal RNAs) to regulate ribosome biogenesis. And Bop1 also act as a component of Pes1\/Bop1\/WDR21 (PeBoW) complex for mature 60S ribosome, and consequently acts during cell division at G1 checkpoints (PMID:18670790; PMID:26940494). What's more, abnormal expression of BOP1 was associated with liver or colorectal cancers(PMID:16804918). The molecular weight of the protein we detected was slightly higher, about 117 kd, which is also seen in the article(PMID: 30100995).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26669 Product name: Recombinant human BOP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC013787 Sequence: MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNT Predict reactive species\nFull Name: block of proliferation 1\nCalculated Molecular Weight: 84 kDa\nObserved Molecular Weight: 117 kDa\nGenBank Accession Number: BC013787\nGene Symbol: BOP1\nGene ID (NCBI): 23246\nRRID: AB_2881123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14137\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869395538089,"sku":"28366-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28366-1-ap","provider":"Iright","version":"1.0","type":"link"}