{"product_id":"proteintech-28369-1-ap","title":"Proteintech, 28369-1-AP, COMP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COMP (28369-1-AP) by Proteintech is a Polyclonal antibody targeting COMP in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples\n28369-1-AP targets COMP in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, mouse cartilage tissue,  rat cartilage tissue,  pig cartilage tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOMP is a secreted pentameric glycoprotein built from modular units and belongs to the thrombospondin protein family. COMP is expressed by hypertrophic chondrocytes and osteoblasts during endochondral ossification, and its expression is increased during fracture healing. COMP is involved in the assembly of collagen fibrils and other structural matrix components. COMP interacts with a number of cartilage ECM proteins, including fibronectin, collagen I, II IX, XII, and XIV, matrilins, as well as proteoglycans such as aggrecan and others.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28749 Product name: Recombinant human COMP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 35-257 aa of BC033676 Sequence: LRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAV Predict reactive species\nFull Name: cartilage oligomeric matrix protein\nCalculated Molecular Weight: 757 aa, 83 kDa\nObserved Molecular Weight: 80-110 kDa\nGenBank Accession Number: BC033676\nGene Symbol: COMP\nGene ID (NCBI): 1311\nRRID: AB_2881126\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49747\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869400584361,"sku":"28369-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28369-1-ap","provider":"Iright","version":"1.0","type":"link"}