{"product_id":"proteintech-28390-1-ap","title":"Proteintech, 28390-1-AP, KAT2A\/GCN5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KAT2A\/GCN5 (28390-1-AP) by Proteintech is a Polyclonal antibody targeting KAT2A\/GCN5 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n28390-1-AP targets KAT2A\/GCN5 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HUVEC cells,  HeLa cells,  LNCaP cells,  MCF-7 cells\nPositive IP detected in: LNCaP cells, hTERT-RPE1 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29005 Product name: Recombinant human KAT2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 366-449 aa of BC032743 Sequence: EIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLR Predict reactive species\nFull Name: K(lysine) acetyltransferase 2A\nCalculated Molecular Weight: 94 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC032743\nGene Symbol: KAT2A\nGene ID (NCBI): 2648\nRRID: AB_3669658\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92830\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887689978025,"sku":"28390-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28390-1-ap","provider":"Iright","version":"1.0","type":"link"}