{"product_id":"proteintech-28404-1-ap","title":"Proteintech, 28404-1-AP, CUL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CUL1 (28404-1-AP) by Proteintech is a Polyclonal antibody targeting CUL1 in WB, IHC, ELISA applications with reactivity to Human samples\n28404-1-AP targets CUL1 in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  MCF-7 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cullin family proteins are scaffold proteins for the Ring finger type E3 ligases. Humans express seven cullin proeins: CUL1-3, CUL4A, CUL4B, CUL5, and CUL7. Each cullin protein can form an E3 ligase similar to the prototype Ring-type E3 ligase Skp1-CUL1-F-box complex. The Cullin-RING-finger type E3 ligases are important regulators in early embryonic development, as highlighted by genetic studies demonstrating that knock-out of CUL1, CUL3, or CUL4A in mice results in early embryonic lethality.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29145 Product name: Recombinant human CUL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 363-533 aa of BC034318 Sequence: PKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDL Predict reactive species\nFull Name: cullin 1\nCalculated Molecular Weight: 90 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC034318\nGene Symbol: CUL1\nGene ID (NCBI): 8454\nRRID: AB_2881135\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13616\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886933987497,"sku":"28404-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28404-1-ap","provider":"Iright","version":"1.0","type":"link"}