{"product_id":"proteintech-28424-1-ap","title":"Proteintech, 28424-1-AP, FBXW7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXW7 (28424-1-AP) by Proteintech is a Polyclonal antibody targeting FBXW7 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n28424-1-AP targets FBXW7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  MCF-7 cells,  mouse brain tissue\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXW7, also named as FBW7, FBX30, SEL10 and hAgo, is a substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It probably recognizes and binds to phosphorylated target proteins. FBXW7 is involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. FBXW7 is a general tumor suppressor in human cancer (PMID: 17909001). FBXW7 has 3 isoforms (α\/β\/γ) with the calculated molecular mass of 80 kDa, 70 kDa and 66 kDa, and apparent molecular mass of 100-110 kDa and 66-75 kDa (PMID: 31346036\/PMID: 22864569). K48 autoubiquitination is consistent with maintenance of ubiquitinated FBW7 (Ub-FBW7, 200 kDa)(PMID: 32353058).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28471 Product name: Recombinant human FBXW7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-227 aa of NM_001349798 Sequence: MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITS Predict reactive species\nFull Name: F-box and WD repeat domain containing 7\nCalculated Molecular Weight: 66 kDa\nObserved Molecular Weight: 100-110 kDa, 66-75 kDa\nGenBank Accession Number: NM_001349798\nGene Symbol: FBXW7\nGene ID (NCBI): 55294\nRRID: AB_2881138\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969H0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868849033385,"sku":"28424-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28424-1-ap","provider":"Iright","version":"1.0","type":"link"}