{"product_id":"proteintech-28454-1-ap","title":"Proteintech, 28454-1-AP, SGK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SGK1 (28454-1-AP) by Proteintech is a Polyclonal antibody targeting SGK1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n28454-1-AP targets SGK1 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: mouse kidney tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerum- and glucocorticoid-induced kinase 1 (SGK1),also named as SGK, is a S\/T protein kinase that belongs to the AGC (cAMP-dependent, cGMP-dependent, and protein kinase C) kinase family. It is expressed in many cell types and participates in numerous cellular processes and it is ubiquitinated and degraded at the ER membrane(PMID: 16847254). The N-terminal motif of SGK1 is critical for its ubiquitination and degradation(PMID:16817852 ). SGK and Akt are likely to phosphorylate related substrates, as they share a similar consensus phosphorylation site (RXRXXS\/T)(PMID:11154281). It has 5 isoforms produced by alternative promoter usage and alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29420 Product name: Recombinant human SGK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC001263 Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQ Predict reactive species\nFull Name: serum\/glucocorticoid regulated kinase 1\nCalculated Molecular Weight: 431 aa, 49 kDa\nObserved Molecular Weight: 42-50 kDa\nGenBank Accession Number: BC001263\nGene Symbol: SGK1\nGene ID (NCBI): 6446\nRRID: AB_2881145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00141\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868914667689,"sku":"28454-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28454-1-ap","provider":"Iright","version":"1.0","type":"link"}