{"product_id":"proteintech-28465-1-ap","title":"Proteintech, 28465-1-AP, DCPS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCPS (28465-1-AP) by Proteintech is a Polyclonal antibody targeting DCPS in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n28465-1-AP targets DCPS in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  mouse testis tissue\nPositive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDcpS, which is a member of the histidine triad (HIT) superfamily of pyrophosphatases, is the first HIT protein with a defined biological function and identifies the HIT motif as a new mRNA decapping domain. DcpS can encode a 38-40 kDa protein, and has the potential to form a homodimer of 80 kDa(PMID: 12198172).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29351 Product name: Recombinant human DCPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-160 aa of BC014532 Sequence: QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRN Predict reactive species\nFull Name: decapping enzyme, scavenger\nCalculated Molecular Weight: 337 aa, 39 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC014532\nGene Symbol: DCPS\nGene ID (NCBI): 28960\nRRID: AB_3086054\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96C86\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887085179049,"sku":"28465-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28465-1-ap","provider":"Iright","version":"1.0","type":"link"}