{"product_id":"proteintech-28472-1-ap","title":"Proteintech, 28472-1-AP, PHF17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHF17 (28472-1-AP) by Proteintech is a Polyclonal antibody targeting PHF17 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n28472-1-AP targets PHF17 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HepG2 cells,  A549 cells,  MCF-7 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHF17, also named as JADE1 and KIAA1807, belongs to the JADE family. PHF17 codes for the Jade-1 protein. This protein interacts with histone acetyltransferase HBO1 and promotes histone acetylation in chromatin to regulate DNA replication and gene transcription. PHF17 is mostly expressed in the small intestine, prostate, mammary gland and kidney. PHF17 is involved in mitosis, meiosis and tumor suppression (PMID: 28134766). PHF17 has 3 isoforms with the molecular mass of 58 kDa and 94-96 kDa. With modification, the MW of PHF17 may be migrated to about 65 kDa and 100-110 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29675 Product name: Recombinant human PHF17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 360-450 aa of BC032376 Sequence: KFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFL Predict reactive species\nFull Name: PHD finger protein 17\nCalculated Molecular Weight: 96 kDa\nObserved Molecular Weight: 65 kDa, 100-110 kDa\nGenBank Accession Number: BC032376\nGene Symbol: PHF17\nGene ID (NCBI): 79960\nRRID: AB_2918168\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6IE81\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869727969449,"sku":"28472-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28472-1-ap","provider":"Iright","version":"1.0","type":"link"}