{"product_id":"proteintech-28476-1-ap","title":"Proteintech, 28476-1-AP, Calpain 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calpain 3 (28476-1-AP) by Proteintech is a Polyclonal antibody targeting Calpain 3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n28476-1-AP targets Calpain 3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalpain 3 (CAPN3), a major intracellular protease, is a muscle-specific member of the calpain large subunit family that specifically binds to titin. CAPN3 plays a role in the dysferlin protein complex and that disruption of CAPN3 function may affect muscle membrane repair and remodeling. CAPN3 has some isoforms with MW of 94, 84, 93, 36, 18 kDa. CAPN3 autolysis generates a small N-terminal fragment of 34 kDa and a large C-terminal fragment whose size ranges from 55 to 60 kDa during self-processing (PMID: 9794799, 14645524).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29454 Product name: Recombinant human CAPN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 488-666 aa of BC146672 Sequence: NRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDM Predict reactive species\nFull Name: calpain 3, (p94)\nObserved Molecular Weight: 90-105 kDa, 55-60 kDa\nGenBank Accession Number: BC146672\nGene Symbol: CAPN3\nGene ID (NCBI): 825\nRRID: AB_2881150\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20807\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869520941225,"sku":"28476-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28476-1-ap","provider":"Iright","version":"1.0","type":"link"}