{"product_id":"proteintech-28478-1-ap","title":"Proteintech, 28478-1-AP, STEAP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STEAP3 (28478-1-AP) by Proteintech is a Polyclonal antibody targeting STEAP3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n28478-1-AP targets STEAP3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-12 cells,  C6 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human appendicitis tissue, mouse liver tissue,  human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTEAP3 (Six-Transmembrane Epithelial Antigen of Prostate 3) is also named as TSAP6, Dudulin-2 and pHyde, and belongs to the STEAP family. STEAP3 is a member of the STEAP family and is composed of a six-transmembrane domain at the COOH-terminal domain and a cytoplasmic N-terminal oxidoreductase domain, which is essential for iron and copper uptake (PMID:16227996). STEAP3 contains a functional p53-binding site in its promoter and can be upregulated following p53 activation to enhance cell death in myeloid leukemia cell line and breast cancer cells (PMID: 18617898). By interacting with Nix, a pro-apoptotic Bcl-2 family member, and Myt1 kinase, a negative regulator of the G2\/M transition, STEAP3 overexpression promotes apoptosis and inhibits G2\/M transition in cell cycle progression (PMID: 12606722, PMID: 10504341).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29528 Product name: Recombinant human STEAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-130 aa of BC042150 Sequence: NPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNA Predict reactive species\nFull Name: STEAP family member 3\nCalculated Molecular Weight: 488 aa, 55 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC042150\nGene Symbol: STEAP3\nGene ID (NCBI): 55240\nRRID: AB_3086055\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q658P3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990034089,"sku":"28478-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28478-1-ap","provider":"Iright","version":"1.0","type":"link"}