{"product_id":"proteintech-28490-1-ap","title":"Proteintech, 28490-1-AP, DDIT4L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDIT4L (28490-1-AP) by Proteintech is a Polyclonal antibody targeting DDIT4L in WB, IHC, ELISA applications with reactivity to human, mouse samples\n28490-1-AP targets DDIT4L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue\nPositive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNA-damage-inducible transcript 4-like protein(DDIT4L), encoded by the stress responsive gene REDD2, is a negative regulator of mTOR signaling, and expressed predominantly in skeletal muscle. It regulates the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1. Also,  DDIT4L involves in oxidized low-density lipoprotein-induced macrophage death sensitivity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29616 Product name: Recombinant human DDIT4L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC013592 Sequence: MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTE Predict reactive species\nFull Name: DNA-damage-inducible transcript 4-like\nCalculated Molecular Weight: 193 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC013592\nGene Symbol: DDIT4L\nGene ID (NCBI): 115265\nRRID: AB_3669660\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96D03\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887106674857,"sku":"28490-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28490-1-ap","provider":"Iright","version":"1.0","type":"link"}