{"product_id":"proteintech-28492-1-ap","title":"Proteintech, 28492-1-AP, Filamin-C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Filamin-C (28492-1-AP) by Proteintech is a Polyclonal antibody targeting Filamin-C in WB, IHC, ELISA applications with reactivity to human samples\n28492-1-AP targets Filamin-C in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SGC-7901 cells\nPositive IHC detected in: human  colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFilamin C (FLNC; also known as γ-FLN; ABP-L; FLN2), a muscle-specific filamin and a large actin-cross-linking protein. Human filamins are ~280 kDa homodimers, each monomer consisting of an N-terminal actin-binding domain followed by 24 immunoglobulin (Ig)-like domains (d1 to d24), the last of which mediates dimerization. FLNC is specifically expressed in cardiomyocytes and skeletal myocytes and is involved in the maintenance of structural integrity. High filamin C associated with better prognosis of prostate cancer, leukemia and breast cancer patients. ( PMID: 25577646, PMID: 30867563, PMID: 31131323)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29328 Product name: Recombinant human filamin-c protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2161-2248 aa of NM_001458 Sequence: DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGL Predict reactive species\nFull Name: filamin C, gamma (actin binding protein 280)\nCalculated Molecular Weight: 291 kDa\nObserved Molecular Weight: 280-300 kDa\nGenBank Accession Number: NM_001458\nGene Symbol: FLNC\nGene ID (NCBI): 2318\nRRID: AB_2918171\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14315\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869461303465,"sku":"28492-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28492-1-ap","provider":"Iright","version":"1.0","type":"link"}