{"product_id":"proteintech-28493-1-ap","title":"Proteintech, 28493-1-AP, NMNAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NMNAT1 (28493-1-AP) by Proteintech is a Polyclonal antibody targeting NMNAT1 in WB, ELISA applications with reactivity to Human, mouse samples\n28493-1-AP targets NMNAT1 in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNMNAT1 is a member of the nicotinamide-nucleotide adenylyltransferases (NMNATs) which catalyze nicotinamide adenine dinucleotide (NAD) synthesis (PMID: 28445802). NMNAT is a central enzyme in NAD biosynthesis, catalyzing the formation of NAD+ from nicotinamide mononucleotide (NMN) and ATP (PMID: 17402747). NMNAT1 is widely expressed with the highest levels in skeletal muscle, heart, and kidney(PMID: 11027696). Mutations in NMNAT1 have been shown associated with the LCA9 form of the retinal degeneration pathology Leber's congenital amaurosis (PMID: 22842229, 22842230).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29584 Product name: Recombinant human NMNAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-152 aa of BC014943 Sequence: GDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPKVK Predict reactive species\nFull Name: nicotinamide nucleotide adenylyltransferase 1\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC014943\nGene Symbol: NMNAT1\nGene ID (NCBI): 64802\nRRID: AB_3086056\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HAN9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869719449769,"sku":"28493-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-28493-1-ap","provider":"Iright","version":"1.0","type":"link"}